PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G163000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 391aa    MW: 42251.2 Da    PI: 5.2528
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G163000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.12.3e-29192246155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k r+rWt+e+H+rFv+av+qLGG e+A Pk+il++m+v+gLt+e+vkSHLQkY+l
  Seita.7G163000.1.p 192 KVRRRWTTEMHDRFVDAVNQLGGCENAKPKAILDIMNVEGLTREQVKSHLQKYKL 246
                         679**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.671189249IPR017930Myb domain
SuperFamilySSF466899.86E-18191248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-28191247IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-23192247IPR006447Myb domain, plants
PfamPF002494.0E-9194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MALQSLPAST GAPCSTSVAS SSSTFSTVIV HGRFPNVTPS IVHSLNAEIW SSDPISYSGV  60
SEQPLGGNYP VLPAEATHSA DQLGDLLNNN DIGVEKQPDC GSVREPNESD DRDEWLRCLV  120
TGRLDDIITA DMTLNYPQMA ESAPDSSYLN SETRQDEHII HQLVSVPTIP GQLYPTVSPP  180
ATINVHSPLR TKVRRRWTTE MHDRFVDAVN QLGGCENAKP KAILDIMNVE GLTREQVKSH  240
LQKYKLAQVR HRPSEVAGTS VDTATSNEGI PSASDVQIRI QEFALQVQIE FQKKLHEMVE  300
RTRRDLLEIH RSVLEKHVMS LHELEERQNL NTDRSILHLL PSPAAGAAAP PSALSAGGSI  360
GVCGEGSRTA ALVEDVQASE AGSLSNKAGA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669170.11e-105PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_008669171.11e-105PREDICTED: protein PHR1-LIKE 1-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16835911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.15e-25G2-like family protein